Protein Info for Rv1822 in Mycobacterium tuberculosis H37Rv

Annotation: Probable CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase PgsA2 (PGP synthase) (phosphatidylglycerophosphate synthase) (3-phosphatidyl-1'-glycerol-3'phosphate synthase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 19 to 48 (30 residues), see Phobius details amino acids 79 to 103 (25 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 153 to 181 (29 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 11 to 167 (157 residues), 124.8 bits, see alignment E=2e-40

Best Hits

Swiss-Prot: 100% identical to PGSA1_MYCTO: Putative CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyl-transferase 1 (pgsA1) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 100% identity to mbt:JTY_1841)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.5

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>Rv1822 Probable CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase PgsA2 (PGP synthase) (phosphatidylglycerophosphate synthase) (3-phosphatidyl-1'-glycerol-3'phosphate synthase) (Mycobacterium tuberculosis H37Rv)
MEPVLTQNRVLTVPNMLSVIRLALIPAFVYVVLSAHANGWGVAILVFSGVSDWADGKIAR
LLNQSSRLGALLDPAVDRLYMVTVPIVFGLSGIVPWWFVLTLLTRDALLAGTLPLLWSRG
LSALPVTYVGKAATFGFMVGFPTILLGQCDPLWSHVLLACGWAFLIWGMYAYLWAFVLYA
VQMTMVVRQMPKLKGRAHRPAAQNAGERG