Protein Info for Rv1771 in Mycobacterium tuberculosis H37Rv

Annotation: L-gulono-1,4-lactone dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 TIGR01679: FAD-linked oxidoreductase" amino acids 5 to 427 (423 residues), 731.6 bits, see alignment E=1.3e-224 PF01565: FAD_binding_4" amino acids 16 to 150 (135 residues), 111.5 bits, see alignment E=2.7e-36 PF04030: ALO" amino acids 172 to 425 (254 residues), 314.3 bits, see alignment E=7.6e-98

Best Hits

Swiss-Prot: 100% identical to GULDH_MYCTU: L-gulono-1,4-lactone dehydrogenase (Rv1771) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00103, L-gulonolactone oxidase [EC: 1.1.3.8] (inferred from 100% identity to mtu:Rv1771)

MetaCyc: 100% identical to L-gulono-1,4-lactone dehydrogenase (Mycobacterium tuberculosis H37Rv)
1.3.2.M1 [EC: 1.3.2.M1]

Predicted SEED Role

"oxidoreductase, FAD-binding"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.3.8

Use Curated BLAST to search for 1.1.3.8 or 1.3.2.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>Rv1771 L-gulono-1,4-lactone dehydrogenase (Mycobacterium tuberculosis H37Rv)
MSPIWSNWPGEQVCAPSAIVRPTSEAELADVIAQAAKRGERVRAVGSGHSFTDIACTDGV
MIDMTGLQRVLDVDQPTGLVTVEGGAKLRALGPQLAQRRLGLENQGDVDPQSITGATATA
THGTGVRFQNLSARIVSLRLVTAGGEVLSLSEGDDYLAARVSLGALGVISQVTLQTVPLF
TLHRHDQRRSLAQTLERLDEFVDGNDHFEFFVFPYADKALTRTMHRSDEQPKPTPGWQRM
VGENFENGGLSLICQTGRRFPSVAPRLNRLMTNMMSSSTVQDRAYKVFATQRKVRFTEME
YAIPRENGREALQRVIDLVRRRSLPIMFPIEVRFSAPDDSFLSTAYGRDTCYIAVHQYAG
MEFESYFRAVEEIMDDYAGRPHWGKRHYQTAATLRERYPQWDRFAAVRDRLDPDRVFLND
YTRRVLGP