Protein Info for Rv1746 in Mycobacterium tuberculosis H37Rv

Annotation: Anchored-membrane serine/threonine-protein kinase PknF (protein kinase F) (STPK F)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 transmembrane" amino acids 306 to 326 (21 residues), see Phobius details PF00069: Pkinase" amino acids 12 to 226 (215 residues), 132.2 bits, see alignment E=3.6e-42 PF07714: PK_Tyr_Ser-Thr" amino acids 13 to 231 (219 residues), 82.9 bits, see alignment E=3.5e-27

Best Hits

Swiss-Prot: 100% identical to PKNF_MYCTO: Serine/threonine-protein kinase PknF (pknF) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K08884, serine/threonine protein kinase, bacterial [EC: 2.7.11.1] (inferred from 100% identity to mbo:Mb1775)

Predicted SEED Role

"Serine/threonine-protein kinase PknF (EC 2.7.11.1)" (EC 2.7.11.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.11.1

Use Curated BLAST to search for 2.7.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (476 amino acids)

>Rv1746 Anchored-membrane serine/threonine-protein kinase PknF (protein kinase F) (STPK F) (Mycobacterium tuberculosis H37Rv)
MPLAEGSTFAGFTIVRQLGSGGMGEVYLARHPRLPRQDALKVLRADVSADGEYRARFNRE
ADAAASLWHPHIVAVHDRGEFDGQLWIDMDFVDGTDTVSLLRDRYPNGMPGPEVTEIITA
VAEALDYAHERRLLHRDVKPANILIANPDSPDRRIMLADFGIAGWVDDPSGLTATNMTVG
TVSYAAPEQLMGNELDGRADQYALAATAFHLLTGSPPFQHANPAVVISQHLSASPPAIGD
RVPELTPLDPVFAKALAKQPKDRYQRCVDFARALGHRLGGAGDPDDTRVSQPVAVAAPAK
RSLLRTAVIVPAVLAMLLVMAVAVAVREFQRADDERAAQPARTRTTTSAGTTTSVAPAST
TRPAPTTPTTTGAADTATASPTAAVVAIGALCFPLGSTGTTKTGATAYCSTLQGTNTTIW
SLTEDTVASPTVTATADPTEAPLPIEQESPIRVCMQQTGQTRRECREEIRRSNGWP