Protein Info for Rv1715 in Mycobacterium tuberculosis H37Rv

Annotation: Probable 3-hydroxybutyryl-CoA dehydrogenase FadB3 (beta-hydroxybutyryl-CoA dehydrogenase) (BHBD)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF02737: 3HCDH_N" amino acids 10 to 174 (165 residues), 161.5 bits, see alignment E=3.2e-51 PF03446: NAD_binding_2" amino acids 11 to 112 (102 residues), 30.3 bits, see alignment E=6.2e-11 PF00725: 3HCDH" amino acids 177 to 275 (99 residues), 75 bits, see alignment E=8.5e-25

Best Hits

KEGG orthology group: K00074, 3-hydroxybutyryl-CoA dehydrogenase [EC: 1.1.1.157] (inferred from 100% identity to mtu:Rv1715)

Predicted SEED Role

"3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Polyhydroxybutyrate metabolism (EC 1.1.1.157)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.157

Use Curated BLAST to search for 1.1.1.157

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>Rv1715 Probable 3-hydroxybutyryl-CoA dehydrogenase FadB3 (beta-hydroxybutyryl-CoA dehydrogenase) (BHBD) (Mycobacterium tuberculosis H37Rv)
MLTSHGFSRAAVVGAGLMGRRIAGVLASAGLDVAITDTNAEILHAAAVEAARVAGAGRGS
VAAAADLAAAIPDADLVIEAVVENLAVKQELFERLATLAPDAVLATNTSVLPIGAVTERV
EDGSRVIGTHFWNPPDLIPVVEVVPSARTAPDTADRVVALLTQVGKLPVRVGRDVPGFIG
NRLQHALWREAIALVAEGVCDPKTVDLVVRNTIGLRLATLGPLENADYIGLDLTLAIHDA
VIPSLNHDPHPSPLLRELVAAGQLGARTGHGFLDWPAGAREATTARLAQHIAAQLQANEK
GRGT