Protein Info for Rv1714 in Mycobacterium tuberculosis H37Rv

Annotation: Probable oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF00106: adh_short" amino acids 23 to 210 (188 residues), 122.3 bits, see alignment E=2.8e-39 PF08659: KR" amino acids 25 to 186 (162 residues), 54.3 bits, see alignment E=2.5e-18 PF13561: adh_short_C2" amino acids 29 to 268 (240 residues), 164.9 bits, see alignment E=3.6e-52

Best Hits

Swiss-Prot: 100% identical to Y1714_MYCTO: Uncharacterized oxidoreductase MT1753.1 (MT1753.1) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_1724)

Predicted SEED Role

"3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Polyhydroxybutyrate metabolism (EC 1.1.1.157)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.157

Use Curated BLAST to search for 1.1.1.157

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>Rv1714 Probable oxidoreductase (Mycobacterium tuberculosis H37Rv)
VEEMALAQQVPNLGLARFSVQDKSILITGATGSLGRVAARALADAGARLTLAGGNSAGLA
ELVNGAGIDDAAVVTCRPDSLADAQQMVEAALGRYGRLDGVLVASGSNHVAPITEMAVED
FDAVMDANVRGAWLVCRAAGRVLLEQGQGGSVVLVSSVRGGLGNAAGYSAYCPSKAGTDL
LAKTLAAEWGGHGIRVNALAPTVFRSAVTEWMFTDDPKGRATREAMLARIPLRRFAEPED
FVGALIYLLSDASSFYTGQVMYLDGGYTAC