Protein Info for Rv1713 in Mycobacterium tuberculosis H37Rv

Annotation: Probable GTP-binding protein EngA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 TIGR03594: ribosome-associated GTPase EngA" amino acids 27 to 453 (427 residues), 504.6 bits, see alignment E=3.9e-155 TIGR00231: small GTP-binding protein domain" amino acids 27 to 153 (127 residues), 65.7 bits, see alignment E=6.4e-22 amino acids 200 to 362 (163 residues), 70.6 bits, see alignment E=2.1e-23 PF01926: MMR_HSR1" amino acids 29 to 143 (115 residues), 83.8 bits, see alignment E=5e-27 amino acids 201 to 319 (119 residues), 79 bits, see alignment E=1.5e-25 PF02421: FeoB_N" amino acids 29 to 148 (120 residues), 35.5 bits, see alignment E=3.7e-12 amino acids 201 to 362 (162 residues), 52.7 bits, see alignment E=1.8e-17 PF00009: GTP_EFTU" amino acids 265 to 369 (105 residues), 35.2 bits, see alignment E=4.7e-12 PF14714: KH_dom-like" amino acids 375 to 453 (79 residues), 87.6 bits, see alignment E=2.8e-28

Best Hits

Swiss-Prot: 100% identical to DER_MYCTO: GTPase Der (der) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03977, GTP-binding protein (inferred from 100% identity to mra:MRA_1723)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>Rv1713 Probable GTP-binding protein EngA (Mycobacterium tuberculosis H37Rv)
VTQDGTWVDESDWQLDDSEIAESGAAPVVAVVGRPNVGKSTLVNRILGRREAVVQDIPGV
TRDRVCYDALWTGRRFVVQDTGGWEPNAKGLQRLVAEQASVAMRTADAVILVVDAGVGAT
AADEAAARILLRSGKPVFLAANKVDSEKGESDAAALWSLGLGEPHAISAMHGRGVADLLD
GVLAALPEVGESASASGGPRRVALVGKPNVGKSSLLNKLAGDQRSVVHEAAGTTVDPVDS
LIELGGDVWRFVDTAGLRRKVGQASGHEFYASVRTHAAIDSAEVAIVLIDASQPLTEQDL
RVISMVIEAGRALVLAYNKWDLVDEDRRELLQREIDRELVQVRWAQRVNISAKTGRAVHK
LVPAMEDALASWDTRIATGPLNTWLTEVTAATPPPVRGGKQPRILFATQATARPPTFVLF
TTGFLEAGYRRFLERRLRETFGFDGSPIRVNVRVREKRAGKRR