Protein Info for Rv1688 in Mycobacterium tuberculosis H37Rv

Annotation: Possible 3-methyladenine DNA glycosylase Mpg

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 TIGR00567: DNA-3-methyladenine glycosylase" amino acids 1 to 188 (188 residues), 247.5 bits, see alignment E=3.9e-78 PF02245: Pur_DNA_glyco" amino acids 7 to 184 (178 residues), 184.8 bits, see alignment E=5.1e-59

Best Hits

Swiss-Prot: 100% identical to 3MGH_MYCTU: Putative 3-methyladenine DNA glycosylase (Rv1688) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03652, DNA-3-methyladenine glycosylase [EC: 3.2.2.21] (inferred from 100% identity to mbt:JTY_1701)

Predicted SEED Role

"DNA-3-methyladenine glycosylase II (EC 3.2.2.21)" in subsystem DNA Repair Base Excision (EC 3.2.2.21)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.21

Use Curated BLAST to search for 3.2.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>Rv1688 Possible 3-methyladenine DNA glycosylase Mpg (Mycobacterium tuberculosis H37Rv)
MNAEELAIDPVAAAHRLLGATIAGRGVRAMVVEVEAYGGVPDGPWPDAAAHSYRGRNGRN
DVMFGPPGRLYTYRSHGIHVCANVACGPDGTAAAVLLRAAAIEDGAELATSRRGQTVRAV
ALARGPGNLCAALGITMADNGIDLFDPSSPVRLRLNDTHRARSGPRVGVSQAADRPWRLW
LTGRPEVSAYRRSSRAPARGASD