Protein Info for Rv1641 in Mycobacterium tuberculosis H37Rv

Annotation: Probable initiation factor if-3 InfC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05198: IF3_N
  • amino acids 7 to 75 (69 residues), 112.4 bits, E=9.1e-37
• TIGR00168: translation initiation factor IF-3
  • amino acids 7 to 168 (162 residues), 200.7 bits, E=6.2e-64
• PF00707: IF3_C
  • amino acids 84 to 167 (84 residues), 110.6 bits, E=2.9e-36

Best Hits

Swiss-Prot: 100% identical to IF3_MYCTU: Translation initiation factor IF-3 (infC) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 99% identity to mbt:JTY_1655)

Predicted SEED Role

"Translation initiation factor 3"

Protein Sequence (201 amino acids)

>Rv1641 Probable initiation factor if-3 InfC (Mycobacterium tuberculosis H37Rv)
ISTETRVNERIRVPEVRLIGPGGEQVGIVRIEDALRVAADADLDLVEVAPNARPPVCKIM
DYGKYKYEAAQKARESRRNQQQTVVKEQKLRPKIDDHDYETKKGHVVRFLEAGSKVKVTI
MFRGREQSRPELGYRLLQRLGADVADYGFIETSAKQDGRNMTMVLAPHRGAKTRARARHP
GEPAGGPPPKPTAGDSKAAPN