Protein Info for Rv1631 in Mycobacterium tuberculosis H37Rv

Annotation: Probable dephospho-CoA kinase CoaE (dephosphocoenzyme a kinase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 TIGR00152: dephospho-CoA kinase" amino acids 4 to 184 (181 residues), 137.5 bits, see alignment E=2.5e-44 PF01121: CoaE" amino acids 4 to 178 (175 residues), 211.2 bits, see alignment E=1e-66 PF04229: GrpB" amino acids 211 to 395 (185 residues), 125.8 bits, see alignment E=1.9e-40

Best Hits

Swiss-Prot: 100% identical to COAE_MYCTU: Dephospho-CoA kinase (coaE) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 100% identity to mbb:BCG_1669)

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>Rv1631 Probable dephospho-CoA kinase CoaE (dephosphocoenzyme a kinase) (Mycobacterium tuberculosis H37Rv)
MLRIGLTGGIGAGKSLLSTTFSQCGGIVVDGDVLAREVVQPGTEGLASLVDAFGRDILLA
DGALDRQALAAKAFRDDESRGVLNGIVHPLVARRRSEIIAAVSGDAVVVEDIPLLVESGM
APLFPLVVVVHADVELRVRRLVEQRGMAEADARARIAAQASDQQRRAVADVWLDNSGSPE
DLVRRARDVWNTRVQPFAHNLAQRQIARAPARLVPADPSWPDQARRIVNRLKIACGHKAL
RVDHIGSTAVSGFPDFLAKDVIDIQVTVESLDVADELAEPLLAAGYPRLEHITQDTEKTD
ARSTVGRYDHTDSAALWHKRVHASADPGRPTNVHLRVHGWPNQQFALLFVDWLAANPGAR
EDYLTVKCDADRRADGELARYVTAKEPWFLDAYQRAWEWADAVHWRP