Protein Info for Rv1605 in Mycobacterium tuberculosis H37Rv

Annotation: Probable cyclase HisF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit" amino acids 13 to 267 (255 residues), 382.3 bits, see alignment E=4.6e-119 PF00977: His_biosynth" amino acids 16 to 250 (235 residues), 279.3 bits, see alignment E=4.6e-87

Best Hits

Swiss-Prot: 100% identical to HIS6_MYCTU: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 100% identity to mbo:Mb1631)

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.-

Use Curated BLAST to search for 4.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>Rv1605 Probable cyclase HisF (Mycobacterium tuberculosis H37Rv)
MYADRDLPGAGGLAVRVIPCLDVDDGRVVKGVNFENLRDAGDPVELAAVYDAEGADELTF
LDVTASSSGRATMLEVVRRTAEQVFIPLTVGGGVRTVADVDSLLRAGADKVAVNTAAIAC
PDLLADMARQFGSQCIVLSVDARTVPVGSAPTPSGWEVTTHGGRRGTGMDAVQWAARGAD
LGVGEILLNSMDADGTKAGFDLALLRAVRAAVTVPVIASGGAGAVEHFAPAVAAGADAVL
AASVFHFRELTIGQVKAALAAEGITVR