Protein Info for Rv1583c in Mycobacterium tuberculosis H37Rv

Annotation: Probable PhiRv1 phage protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF10888: DUF2742" amino acids 36 to 129 (94 residues), 133.1 bits, see alignment E=2.1e-43

Best Hits

Swiss-Prot: 100% identical to Y1583_MYCTO: Uncharacterized protein MT3573.2 (MT3573.2) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 99% identity to mbo:Mb1609c)

Predicted SEED Role

"Probable phiRv1 phage protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (132 amino acids)

>Rv1583c Probable PhiRv1 phage protein (Mycobacterium tuberculosis H37Rv)
MTAGAGGSPPTRRCPATEDRAPATVATPSSADPTASRAVSWWSVHEHVAPVLDAAGSWPM
AGTPAWRQLDDADPRKWAAICDAARHWALRVETCQEAMAQASRDVSAAADWPGIAREIVR
RRGVYIPRAGVA