Protein Info for Rv1569 in Mycobacterium tuberculosis H37Rv

Annotation: Probable 8-amino-7-oxononanoate synthase BioF1 (AONS) (8-amino-7-ketopelargonate synthase) (7-keto-8-amino-pelargonic acid synthetase) (7-KAP synthetase) (L-alanine--pimelyl CoA ligase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF00155: Aminotran_1_2" amino acids 43 to 374 (332 residues), 199 bits, see alignment E=2.1e-62 PF00266: Aminotran_5" amino acids 81 to 210 (130 residues), 28.6 bits, see alignment E=1.1e-10 PF01041: DegT_DnrJ_EryC1" amino acids 85 to 217 (133 residues), 27.3 bits, see alignment E=3.4e-10

Best Hits

Swiss-Prot: 100% identical to BIOF_MYCTA: 8-amino-7-oxononanoate synthase (MRA_1581) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K00652, 8-amino-7-oxononanoate synthase [EC: 2.3.1.47] (inferred from 100% identity to mtb:TBMG_02409)

Predicted SEED Role

"8-amino-7-oxononanoate synthase (EC 2.3.1.47)" in subsystem Biotin biosynthesis (EC 2.3.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.47

Use Curated BLAST to search for 2.3.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>Rv1569 Probable 8-amino-7-oxononanoate synthase BioF1 (AONS) (8-amino-7-ketopelargonate synthase) (7-keto-8-amino-pelargonic acid synthetase) (7-KAP synthetase) (L-alanine--pimelyl CoA ligase) (Mycobacterium tuberculosis H37Rv)
MKAATQARIDDSPLAWLDAVQRQRHEAGLRRCLRPRPAVATELDLASNDYLGLSRHPAVI
DGGVQALRIWGAGATGSRLVTGDTKLHQQFEAELAEFVGAAAGLLFSSGYTANLGAVVGL
SGPGSLLVSDARSHASLVDACRLSRARVVVTPHRDVDAVDAALRSRDEQRAVVVTDSVFS
ADGSLAPVRELLEVCRRHGALLLVDEAHGLGVRGGGRGLLYELGLAGAPDVVMTTTLSKA
LGSQGGVVLGPTPVRAHLIDAARPFIFDTGLAPAAVGAARAALRVLQAEPWRPQAVLNHA
GELARMCGVAAVPDSAMVSVILGEPESAVAAAAACLDAGVKVGCFRPPTVPAGTSRLRLT
ARASLNAGELELARRVLTDVLAVARR