Protein Info for Rv1555 in Mycobacterium tuberculosis H37Rv

Annotation: Probable fumarate reductase [membrane anchor subunit] FrdD (fumarate dehydrogenase) (fumaric hydrogenase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 transmembrane" amino acids 19 to 45 (27 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details PF02313: Fumarate_red_D" amino acids 11 to 123 (113 residues), 116.6 bits, see alignment E=3.6e-38

Best Hits

Swiss-Prot: 100% identical to FRDD_MYCBT: Fumarate reductase subunit D (frdD) from Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

KEGG orthology group: K00247, fumarate reductase subunit D (inferred from 100% identity to mtc:MT1606)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>Rv1555 Probable fumarate reductase [membrane anchor subunit] FrdD (fumarate dehydrogenase) (fumaric hydrogenase) (Mycobacterium tuberculosis H37Rv)
MTPSTSDARSRRRSAEPFLWLLFSAGGMVTALVAPVLLLLFGLAFPLGWLDAPDHGHLLA
MVRNPITKLVVLVLVVLALFHAAHRFRFVLDHGLQLGRFDRVIALWCYGMAVLGSATAGW
MLLTM