Protein Info for Rv1554 in Mycobacterium tuberculosis H37Rv

Annotation: Probable fumarate reductase [membrane anchor subunit] FrdC (fumarate dehydrogenase) (fumaric hydrogenase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details PF02300: Fumarate_red_C" amino acids 3 to 124 (122 residues), 144.8 bits, see alignment E=7.4e-47

Best Hits

Swiss-Prot: 100% identical to FRDC_MYCTA: Fumarate reductase subunit C (frdC) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K00246, fumarate reductase subunit C (inferred from 99% identity to mtf:TBFG_11586)

MetaCyc: 31% identical to fumarate reductase membrane protein FrdC (Escherichia coli K-12 substr. MG1655)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Fumarate reductase subunit C" in subsystem Succinate dehydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (126 amino acids)

>Rv1554 Probable fumarate reductase [membrane anchor subunit] FrdC (fumarate dehydrogenase) (fumaric hydrogenase) (Mycobacterium tuberculosis H37Rv)
MSAYRQPVERYWWARRRSYLRFMLREISCIFVAWFVLYLMLVLRAVGAGGNSYQRFLDFS
ANPVVVVLNVVALSFLLLHAVTWFGSAPRAMVIQVRGRRVPARAVLAGHYAAWLVVSVIV
AWMVLS