Protein Info for Rv1510 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved probable membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details amino acids 353 to 376 (24 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details amino acids 408 to 428 (21 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to Y1510_MYCTU: Uncharacterized protein Rv1510 (Rv1510) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_1522)

Predicted SEED Role

"Possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>Rv1510 Conserved probable membrane protein (Mycobacterium tuberculosis H37Rv)
MYERRHERGMCDRAVEMTDVGATAAPTGPIARGSVARVGAATALAVACVYTVIYLAARDL
PPACFSIFAVFWGALGIATGATHGLLQETTREVRWVRSTQIVAGHRTHPLRVAGMIGTVA
AVVIAGSSPLWSRQLFVEGRWLSVGLLSVGVAGFCAQATLLGALAGVDRWTQYGSLMVTD
AVIRLAVAAAAVVIGWGLAGYLWAATAGAVAWLLMLMASPTARSAASLLTPGGIATFVRG
AAHSITAAGASAILVMGFPVLLKVTSDQLGAKGGAVILAVTLTRAPLLVPLSAMQGNLIA
HFVDRRTQRLRALIAPALVVGGIGAVGMLAAGLTGPWLLRVGFGPDYQTGGALLAWLTAA
AVAIAMLTLTGAAAVAAALHRAYLLGWVSATVASTLLLLLPMPLETRTVIALLFGPTVGI
AIHVAALARRPD