Protein Info for Rv1491c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 93 to 121 (29 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details PF09335: VTT_dom" amino acids 84 to 200 (117 residues), 85.7 bits, see alignment E=1.9e-28

Best Hits

Swiss-Prot: 100% identical to Y1491_MYCTU: TVP38/TMEM64 family membrane protein Rv1491c (Rv1491c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbo:Mb1528c)

Predicted SEED Role

"DedA family protein paralog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>Rv1491c Conserved membrane protein (Mycobacterium tuberculosis H37Rv)
VTAPAICNTTETVHGIATSLGAVARQASLPRIVGTVVGITVLVVVALLVPVPTAVELRDW
AKSLGAWFPLAFLLVHTVVTVPPFPRTAFTLAAGLLFGSVVGVFIAVVGSTASAVIAMLL
VRATGWQLNSLVRRRAINRLDERLRERGWLAILSLRLIPVVPFAAINYAAGASGVRILSF
AWATLAGLLPGTAAVVILGDAFAGSGSPLLILVSVCTGALGLTGLVYEIRNYRRQHRRMP
GYDDPVREPALI