Protein Info for Rv1448c in Mycobacterium tuberculosis H37Rv

Annotation: Probable transaldolase Tal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00876: transaldolase
  • amino acids 14 to 363 (350 residues), 693.9 bits, E=2.3e-213
• PF00923: TAL_FSA
  • amino acids 18 to 363 (346 residues), 294.3 bits, E=5e-92

Best Hits

Swiss-Prot: 100% identical to TAL_MYCTU: Transaldolase (tal) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 100% identity to mbb:BCG_1509c)

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

• pentose phosphate pathway (8/8 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• Bifidobacterium shunt (12/15 steps found)
• Rubisco shunt (8/10 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.2

Protein Sequence (373 amino acids)

>Rv1448c Probable transaldolase Tal (Mycobacterium tuberculosis H37Rv)
MTAQNPNLAALSAAGVSVWLDDLSRDRLRSGNLQELIDTKSVVGVTTNPSIFQKALSEGH
TYDAQIAELAARGADVDATIRTVTTDDVRSACDVLVPQWEDSDGVDGRVSIEVDPRLAHE
TEKTIQQAIELWKIVDRPNLFIKIPATKAGLPAISAVLAEGISVNVTLIFSVQRYREVMD
AYLTGMEKARQAGHSLSKIHSVASFFVSRVDTEIDKRLDRIGSRQALELRGQAGVANARL
AYATYREVFEDSDRYRSLKVDGARVQRPLWASTGVKNPDYSDTLYVTELVAPHTVNTMPE
KTIDAVADHGVIQGDTVTGTASDAQAVFDQLGAIGIDLTDVFAVLEEEGVRKFEASWNEL
LQETRAHLDTAAQ