Protein Info for Rv1426c in Mycobacterium tuberculosis H37Rv

Annotation: Probable esterase LipO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 75 to 94 (20 residues), see Phobius details PF00135: COesterase" amino acids 174 to 273 (100 residues), 51.5 bits, see alignment E=1.7e-17 PF20434: BD-FAE" amino acids 175 to 370 (196 residues), 139.7 bits, see alignment E=2e-44 PF07859: Abhydrolase_3" amino acids 182 to 390 (209 residues), 68 bits, see alignment E=2e-22 PF00326: Peptidase_S9" amino acids 205 to 412 (208 residues), 47.1 bits, see alignment E=4.5e-16

Best Hits

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 100% identity to mbo:Mb1461c)

Predicted SEED Role

"Lipase (EC 3.1.1.3)" (EC 3.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-, 3.1.1.3

Use Curated BLAST to search for 3.1.-.- or 3.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>Rv1426c Probable esterase LipO (Mycobacterium tuberculosis H37Rv)
MRFRRMARPRPLTRAAVELLNAANGLRPLSGSGYSTVLAFWLGWPTSEVPGVYLGASVLD
ALRRGRRGDFGGLKGKAALALTAAAWVILAVIRYRGATTPGPVLEAGLTEQLGPDYAKEL
ATLPTEPMRSRGRNLPLRTAMARRRYVETTNVVCYGPYGRANLADIWRRRDLPRDAKAPV
LVQVPGGAWVLGWRRPQAYPLMSHLAARGWVCVSLNYRVSPRHTWPDHIVDVKRALAWVK
ENIAAYGGDPNFVAISGGSAGGHLCALAALTPNDPRFQPGFEQVDTSVAAAVPVYGRYDW
FTTDAPGRREFVGLLETFVVKRKFSTHRDIFVDASPIHHVRADAPPFFVLHGRHDSLIPV
AEAHAFVEELRAVSKSPVAYADLPHAQHAFDVFGSPRAHHTAEAVARFLSWVYATNPPAT