Protein Info for Rv1412 in Mycobacterium tuberculosis H37Rv

Annotation: Probable riboflavin synthase alpha chain RibC (RibE)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00187: riboflavin synthase, alpha subunit
  • amino acids 1 to 198 (198 residues), 196.9 bits, E=1.1e-62
• PF00677: Lum_binding
  • amino acids 3 to 87 (85 residues), 79.3 bits, E=8.6e-27
  • amino acids 100 to 187 (88 residues), 91.5 bits, E=1.4e-30

Best Hits

Swiss-Prot: 100% identical to RISA_MYCTU: Riboflavin synthase (ribE) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00793, riboflavin synthase [EC: 2.5.1.9] (inferred from 100% identity to mbo:Mb1447)

Predicted SEED Role

"Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9)" (EC 2.5.1.9)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.9

Protein Sequence (201 amino acids)

>Rv1412 Probable riboflavin synthase alpha chain RibC (RibE) (Mycobacterium tuberculosis H37Rv)
MFTGIVEERGEVTGREALVDAARLTIRGPMVTADAGHGDSIAVNGVCLTVVDVLPDGQFT
ADVMAETLNRSNLGELRPGSRVNLERAAALGSRLGGHIVQGHVDATGEIVARCPSEHWEV
VRIEMPASVARYVVEKGSITVDGISLTVSGLGAEQRDWFEVSLIPTTRELTTLGSAAVGT
RVNLEVDVVAKYVERLMRSAG