Protein Info for Rv1392 in Mycobacterium tuberculosis H37Rv

Annotation: Probable S-adenosylmethionine synthetase MetK (mat) (AdoMet synthetase) (methionine adenosyltransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01034: methionine adenosyltransferase
  • amino acids 7 to 403 (397 residues), 538.8 bits, E=3.4e-166
• PF00438: S-AdoMet_synt_N
  • amino acids 7 to 106 (100 residues), 129.8 bits, E=7.4e-42
• PF02772: S-AdoMet_synt_M
  • amino acids 130 to 251 (122 residues), 154 bits, E=2.8e-49
• PF02773: S-AdoMet_synt_C
  • amino acids 253 to 392 (140 residues), 219.3 bits, E=2.5e-69

Best Hits

Swiss-Prot: 100% identical to METK_MYCTA: S-adenosylmethionine synthase (metK) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 100% identity to mbo:Mb1427)

MetaCyc: 61% identical to S-adenosylmethionine synthetase monomer (Bacillus subtilis)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• S-adenosyl-L-methionine salvage II (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• S-adenosyl-L-methionine salvage I (3/4 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• superpathway of L-methionine salvage and degradation (10/16 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• L-methionine salvage cycle III (3/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (3/12 steps found)
• L-methionine salvage cycle II (plants) (2/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Protein Sequence (403 amino acids)

>Rv1392 Probable S-adenosylmethionine synthetase MetK (mat) (AdoMet synthetase) (methionine adenosyltransferase) (Mycobacterium tuberculosis H37Rv)
VSEKGRLFTSESVTEGHPDKICDAISDSVLDALLAADPRSRVAVETLVTTGQVHVVGEVT
TSAKEAFADITNTVRARILEIGYDSSDKGFDGATCGVNIGIGAQSPDIAQGVDTAHEARV
EGAADPLDSQGAGDQGLMFGYAINATPELMPLPIALAHRLSRRLTEVRKNGVLPYLRPDG
KTQVTIAYEDNVPVRLDTVVISTQHAADIDLEKTLDPDIREKVLNTVLDDLAHETLDAST
VRVLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMR
WVAKNVVAAGLAERVEVQVAYAIGKAAPVGLFVETFGTETEDPVKIEKAIGEVFDLRPGA
IIRDLNLLRPIYAPTAAYGHFGRTDVELPWEQLDKVDDLKRAI