Protein Info for Rv1372 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 132 to 153 (22 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 340 to 359 (20 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details PF00195: Chal_sti_synt_N" amino acids 33 to 235 (203 residues), 83.8 bits, see alignment E=3.1e-27 PF08392: FAE1_CUT1_RppA" amino acids 131 to 239 (109 residues), 41.8 bits, see alignment E=2.2e-14 PF08545: ACP_syn_III" amino acids 174 to 238 (65 residues), 35.6 bits, see alignment E=1.8e-12 PF02797: Chal_sti_synt_C" amino acids 251 to 389 (139 residues), 76.4 bits, see alignment E=6.2e-25 PF08541: ACP_syn_III_C" amino acids 299 to 389 (91 residues), 40.4 bits, see alignment E=6.8e-14

Best Hits

Swiss-Prot: 100% identical to PKS18_MYCBO: Alpha-pyrone synthesis polyketide synthase-like Pks18 (pks18) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_1407)

Predicted SEED Role

"Chalcone synthase (EC 2.3.1.74)" in subsystem Flavanone biosynthesis (EC 2.3.1.74)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.74

Use Curated BLAST to search for 2.3.1.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>Rv1372 Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv)
MNVSAESGAPRRAGQRHEVGLAQLPPAPPTTVAVIEGLATGTPRRVVNQSDAADRVAELF
LDPGQRERIPRVYQKSRITTRRMAVDPLDAKFDVFRREPATIRDRMHLFYEHAVPLAVDV
SKRALAGLPYRAAEIGLLVLATSTGFIAPGVDVAIVKELGLSPSISRVVVNFMGCAAAMN
ALGTATNYVRAHPAMKALVVCIELCSVNAVFADDINDVVIHSLFGDGCAALVIGASQVQE
KLEPGKVVVRSSFSQLLDNTEDGIVLGVNHNGITCELSENLPGYIFSGVAPVVTEMLWDN
GLQISDIDLWAIHPGGPKIIEQSVRSLGISAELAAQSWDVLARFGNMLSVSLIFVLETMV
QQAESAKAISTGVAFAFGPGVTVEGMLFDIIRR