Protein Info for Rv1322A in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00903: Glyoxalase
  • amino acids 20 to 147 (128 residues), 66.4 bits, E=5e-22
• TIGR03081: methylmalonyl-CoA epimerase
  • amino acids 21 to 149 (129 residues), 126.7 bits, E=4.2e-41
• PF13468: Glyoxalase_3
  • amino acids 21 to 128 (108 residues), 39.6 bits, E=8.5e-14
• PF13669: Glyoxalase_4
  • amino acids 22 to 134 (113 residues), 75.6 bits, E=5.7e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_11354)

MetaCyc: 41% identical to methylmalonyl CoA epimerase subunit (Propionibacterium freudenreichii shermanii)
Methylmalonyl-CoA epimerase. [EC: 5.1.99.1]

Predicted SEED Role

"Methylmalonyl-CoA epimerase (EC 5.1.99.1); Ethylmalonyl-CoA epimerase" (EC 5.1.99.1)

MetaCyc Pathways

• propanoyl CoA degradation I (3/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• pyruvate fermentation to propanoate I (5/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (8/13 steps found)
• superpathway of L-methionine salvage and degradation (10/16 steps found)
• 3-hydroxypropanoate cycle (7/13 steps found)
• methylaspartate cycle (11/19 steps found)
• L-glutamate degradation VIII (to propanoate) (5/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• ethylmalonyl-CoA pathway (2/11 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (3/14 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.99.1

Protein Sequence (152 amino acids)

>Rv1322A Conserved protein (Mycobacterium tuberculosis H37Rv)
VMTTDQVHARHMLATSLVTGLDHVGIAVADLDVAIEWYHDHLGMILVHEEINDDQGIREA
LLAVPGSAAQIQLMAPLDESSVIAKFLDKRGPGIQQLACRVSDLDAMCRRLRSQGVRLVY
ETARRGTANSRINFIHPKDAGGVLIELVEPAP