Protein Info for Rv1319c in Mycobacterium tuberculosis H37Rv

Annotation: Possible adenylate cyclase (ATP pyrophosphate-lyase) (adenylyl cyclase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 transmembrane" amino acids 54 to 77 (24 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 222 to 245 (24 residues), see Phobius details amino acids 257 to 281 (25 residues), see Phobius details PF00672: HAMP" amino acids 276 to 327 (52 residues), 36.3 bits, see alignment 5.6e-13 PF00211: Guanylate_cyc" amino acids 361 to 524 (164 residues), 51.1 bits, see alignment E=1.3e-17

Best Hits

Swiss-Prot: 100% identical to Y1353_MYCBO: Uncharacterized protein Mb1353c (BQ2027_MB1353C) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K01768, adenylate cyclase [EC: 4.6.1.1] (inferred from 100% identity to mtb:TBMG_02661)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (535 amino acids)

>Rv1319c Possible adenylate cyclase (ATP pyrophosphate-lyase) (adenylyl cyclase) (Mycobacterium tuberculosis H37Rv)
MPAKKTMAQRLGQALETMTRQCGQLPETPAYGSWLLGRVSESPSRRWVRIKRIVTVYIMT
ANLTGIVVALLVVTFAFPVPSIYTDAPWWVTFGVAPAYATLALAIGTYWITTRIVRASIR
WAIEERAPSQADGRNTLLLPFRVAAVHLILWDIGGALLATLYGLANRVFVTIILFSVTIC
GVLVATNCYLFTEFALRPVAAKALEAGRPPRRFAPGIMGRTMTVWSLGSGVPVTGIATTA
LYVLLVHNLTETQLASAVLILSITTLIFGFLVMWILAWLTAAPVRVVRAALKRVEQGDLR
GDLVVFDGTELGELQRGFNAMVNGLRERERVRDLFGRHVGREVAAAAERERPQLGGEDRH
AAVVFVDIVGSTQLVDNQPAAHVVKLLNRFFAIVVNEVDRHHGLINKFAGDAALAIFGAP
NRLDRPEDAALAAARAIADRLANEMPEVQAGIGVAAGQIVAGNVGAKQRFEYTVVGKPVN
QAARLCELAKSHPARLLASSDTLHAASETERAHWSLGETVTLRGHEQPTRLAVPT