Protein Info for Rv1313c in Mycobacterium tuberculosis H37Rv

Annotation: Possible transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 410 to 426 (17 residues), see Phobius details PF14690: Zn_ribbon_ISL3" amino acids 47 to 92 (46 residues), 44.2 bits, see alignment 3e-15 PF13542: HTH_Tnp_ISL3" amino acids 97 to 147 (51 residues), 52.3 bits, see alignment 4.8e-18 PF01610: DDE_Tnp_ISL3" amino acids 163 to 420 (258 residues), 225.2 bits, see alignment E=1.6e-70

Best Hits

Swiss-Prot: 100% identical to TS57_MYCTU: Transposase for insertion sequence element IS1557 (Rv1313c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K07485, transposase (inferred from 100% identity to mtc:MT1353)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>Rv1313c Possible transposase (Mycobacterium tuberculosis H37Rv)
VRNVRLFRALLGVDKRTVIEDIEFEEDDAGDGARVIARVRPRSAVLRRCGRCGRKASWYD
RGAGLRQWRSLDWGTVEVFLEAEAPRVNCPTHGPTVVAVPWARHHAGHTYAFDDTVAWLA
VACSKTAVCELMRIAWRTVGAIVARVWADTEKRIDRFANLRRIGIDEISYKRHHRYLTVV
VDHDSGRLVWAAPGHDKATLGLFFDALGAERAAQITHVSADAADWIADVVTERCPDAIQC
ADPFHVVAWATEALDVERRRAWNDARAIARTEPKWGRGRPGKNAAPRPGRERARRLKGAR
YALWKNPEDLTERQSAKLAWIAKTDPRLYRAYLLKESLRHVFSVKGEEGKQALDRWISWA
QRCRIPVFVELAARIKRHRVAIDAALDHGLSQGLIESTNTKIRLLTRIAFGFRSPQALIA
LAMLTLAGHRPTLPGRHNHPQISQ