Protein Info for Rv1288 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF01476: LysM" amino acids 6 to 51 (46 residues), 24.1 bits, see alignment 4.1e-09 amino acids 56 to 102 (47 residues), 32.1 bits, see alignment 1.4e-11 amino acids 107 to 152 (46 residues), 37.5 bits, see alignment 2.8e-13 PF05489: Phage_tail_X" amino acids 7 to 56 (50 residues), 25.7 bits, see alignment 1e-09 amino acids 59 to 107 (49 residues), 22 bits, see alignment 1.5e-08 PF00756: Esterase" amino acids 182 to 442 (261 residues), 204 bits, see alignment E=5.4e-64

Best Hits

Swiss-Prot: 100% identical to Y1288_MYCTU: Uncharacterized protein Rv1288 (Rv1288) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_1296)

Predicted SEED Role

"Putative esterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>Rv1288 Conserved protein (Mycobacterium tuberculosis H37Rv)
MVSTHAVVAGETLSALALRFYGDAELYRLIAAASGIADPDVVNVGQRLIMPDFTRYTVVA
GDTLSALALRFYGDAELNWLIAAASGIADPDVVNVGQRLIMPDFTRYTVVAGDTLSALAA
RFYGDASLYPLIAAVNGIADPGVIDVGQVLVIFIGRSDGFGLRIVDRNENDPRLWYYRFQ
TSAIGWNPGVNVLLPDDYRTSGRTYPVLYLFHGGGTDQDFRTFDFLGIRDLTAGKPIIIV
MPDGGHAGWYSNPVSSFVGPRNWETFHIAQLLPWIEANFRTYAEYDGRAVAGFSMGGFGA
LKYAAKYYGHFASASSHSGPASLRRDFGLVVHWANLSSAVLDLGGGTVYGAPLWDQARVS
ADNPVERIDSYRNKRIFLVAGTSPDPANWFDSVNETQVLAGQREFRERLSNAGIPHESHE
VPGGHVFRPDMFRLDLDGIVARLRPASIGAAAERAD