Protein Info for Rv1264 in Mycobacterium tuberculosis H37Rv

Annotation: Adenylyl cyclase (ATP pyrophosphate-lyase) (adenylate cyclase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 PF16701: Ad_Cy_reg" amino acids 10 to 194 (185 residues), 297.6 bits, see alignment E=3.8e-93 PF00211: Guanylate_cyc" amino acids 214 to 372 (159 residues), 43.2 bits, see alignment E=3.5e-15

Best Hits

Swiss-Prot: 100% identical to Y1264_MYCTO: pH-sensitive adenylate cyclase MT1302 (MT1302) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01768, adenylate cyclase [EC: 4.6.1.1] (inferred from 100% identity to mbb:BCG_1323)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>Rv1264 Adenylyl cyclase (ATP pyrophosphate-lyase) (adenylate cyclase) (Mycobacterium tuberculosis H37Rv)
VTDHVREADDANIDDLLGDLGGTARAERAKLVEWLLEQGITPDEIRATNPPLLLATRHLV
GDDGTYVSAREISENYGVDLELLQRVQRAVGLARVDDPDAVVHMRADGEAAARAQRFVEL
GLNPDQVVLVVRVLAEGLSHAAEAMRYTALEAIMRPGATELDIAKGSQALVSQIVPLLGP
MIQDMLFMQLRHMMETEAVNAGERAAGKPLPGARQVTVAFADLVGFTQLGEVVSAEELGH
LAGRLAGLARDLTAPPVWFIKTIGDAVMLVCPDPAPLLDTVLKLVEVVDTDNNFPRLRAG
VASGMAVSRAGDWFGSPVNVASRVTGVARPGAVLVADSVREALGDAPEADGFQWSFAGPR
RLRGIRGDVRLFRVRRGATRTGSGGAAQDDDLAGSSP