Protein Info for Rv1258c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 46 to 68 (23 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 224 to 241 (18 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 374 to 395 (22 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 363 (352 residues), 109.4 bits, see alignment E=1.9e-35 amino acids 254 to 398 (145 residues), 49 bits, see alignment E=4.6e-17 PF05977: MFS_3" amino acids 12 to 414 (403 residues), 67.4 bits, see alignment E=9.3e-23

Best Hits

Swiss-Prot: 100% identical to TAP_MYCTU: Multidrug efflux pump Tap (tap) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv1258c)

Predicted SEED Role

"Macrolide-efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>Rv1258c Probable conserved integral membrane transport protein (Mycobacterium tuberculosis H37Rv)
MRNSNRGPAFLILFATLMAAAGDGVSIVAFPWLVLQREGSAGQASIVASATMLPLLFATL
VAGTAVDYFGRRRVSMVADALSGAAVAGVPLVAWGYGGDAVNVLVLAVLAALAAAFGPAG
MTARDSMLPEAAARAGWSLDRINGAYEAILNLAFIVGPAIGGLMIATVGGITTMWITATA
FGLSILAIAALQLEGAGKPHHTSRPQGLVSGIAEGLRFVWNLRVLRTLGMIDLTVTALYL
PMESVLFPKYFTDHQQPVQLGWALMAIAGGGLVGALGYAVLAIRVPRRVTMSTAVLTLGL
ASMVIAFLPPLPVIMVLCAVVGLVYGPIQPIYNYVIQTRAAQHLRGRVVGVMTSLAYAAG
PLGLLLAGPLTDAAGLHATFLALALPIVCTGLVAIRLPALRELDLAPQADIDRPVGSAQ