Protein Info for Rv1253 in Mycobacterium tuberculosis H37Rv

Annotation: Probable cold-shock DeaD-box protein A homolog DeaD (ATP-dependent RNA helicase dead homolog)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 PF00270: DEAD" amino acids 37 to 202 (166 residues), 162.2 bits, see alignment E=1.9e-51 PF04851: ResIII" amino acids 58 to 197 (140 residues), 22.5 bits, see alignment E=1.9e-08 PF00271: Helicase_C" amino acids 237 to 345 (109 residues), 106.2 bits, see alignment E=2.3e-34 PF03880: DbpA" amino acids 471 to 540 (70 residues), 72.8 bits, see alignment E=3.9e-24

Best Hits

Swiss-Prot: 100% identical to DEAD_MYCTU: ATP-dependent RNA helicase DeaD (deaD) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K05592, ATP-dependent RNA helicase DeaD [EC: 3.6.4.13] (inferred from 100% identity to mtu:Rv1253)

MetaCyc: 48% identical to ATP-dependent RNA helicase DeaD (Escherichia coli K-12 substr. MG1655)
5.6.2.e [EC: 5.6.2.e]

Predicted SEED Role

"DEAD-box ATP-dependent RNA helicase CshA (EC 3.6.4.13)" (EC 3.6.4.13)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.4.13 or 5.6.2.e

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (563 amino acids)

>Rv1253 Probable cold-shock DeaD-box protein A homolog DeaD (ATP-dependent RNA helicase dead homolog) (Mycobacterium tuberculosis H37Rv)
MAFPEYSPAASAATFADLQIHPRVLRAIGDVGYESPTAIQAATIPALMAGSDVVGLAQTG
TGKTAAFAIPMLSKIDITSKVPQALVLVPTRELALQVAEAFGRYGAYLSQLNVLPIYGGS
SYAVQLAGLRRGAQVVVGTPGRMIDHLERATLDLSRVDFLVLDEADEMLTMGFADDVERI
LSETPEYKQVALFSATMPPAIRKLSAKYLHDPFEVTCKAKTAVAENISQSYIQVARKMDA
LTRVLEVEPFEAMIVFVRTKQATEEIAEKLRARGFSAAAISGDVPQAQRERTITALRDGD
IDILVATDVAARGLDVERISHVLNYDIPHDTESYVHRIGRTGRAGRSGAALIFVSPRELH
LLKAIEKATRQTLTEAQLPTVEDVNTQRVAKFADSITNALGGPGIELFRRLVEEYEREHD
VPMADIAAALAVQCRGGEAFLMAPDPPLSRRNRDQRRDRPQRPKRRPDLTTYRVAVGKRH
KIGPGAIVGAIANEGGLHRSDFGQIRIGPDFSLVELPAKLPRATLKKLAQTRISGVLIDL
RPYRPPDAARRHNGGKPRRKHVG