Protein Info for Rv1245c in Mycobacterium tuberculosis H37Rv

Annotation: Probable short-chain type dehydrogenase/reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00106: adh_short" amino acids 7 to 201 (195 residues), 170.1 bits, see alignment E=6.4e-54 PF08659: KR" amino acids 10 to 172 (163 residues), 50.9 bits, see alignment E=2.7e-17 PF13561: adh_short_C2" amino acids 13 to 228 (216 residues), 114.6 bits, see alignment E=8.3e-37

Best Hits

Swiss-Prot: 65% identical to SADH_MYCTU: Putative oxidoreductase SadH (sadH) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv1245c)

Predicted SEED Role

"Oxidoreductase, short-chain dehydrogenase/reductase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>Rv1245c Probable short-chain type dehydrogenase/reductase (Mycobacterium tuberculosis H37Rv)
MEGFAGKVAVVTGAGSGIGQALAIELARSGAKVAISDVDTDGLADTEHRLKAISTPVKTD
RLDVTEREAFLAYADAVNEHFGTVNQIYNNAGIAFTGDIEVSQFKDIERVMDVDFWGVVN
GTKAFLPHLIASGDGHVINISSVFGLFSAPGQAAYNSAKFAVRGFTEALRQEMALAGHPV
KVTTVHPGGVKTAIARNATAAEGLDQAELAETFDKRVAHLSPQRAAQIILTGVAKNKARV
LVGVDAKVLDLVVRLTGSGYQRIFPIITGRLIPRPR