Protein Info for Rv1235 in Mycobacterium tuberculosis H37Rv

Annotation: Probable sugar-binding lipoprotein LpqY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF01547: SBP_bac_1" amino acids 42 to 373 (332 residues), 117.3 bits, see alignment E=1.4e-37 PF13416: SBP_bac_8" amino acids 50 to 404 (355 residues), 60.3 bits, see alignment E=2.7e-20

Best Hits

Swiss-Prot: 100% identical to LPQY_MYCTU: Trehalose-binding lipoprotein LpqY (lpqY) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 100% identity to mtu:Rv1235)

MetaCyc: 100% identical to trehalose-binding lipoprotein (Mycobacterium tuberculosis H37Rv)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, substrate binding periplasmic protein MalE" in subsystem Bacterial Chemotaxis or Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>Rv1235 Probable sugar-binding lipoprotein LpqY (Mycobacterium tuberculosis H37Rv)
VVMSRGRIPRLGAAVLVALTTAAAACGADSQGLVVSFYTPATDGATFTAIAQRCNQQFGG
RFTIAQVSLPRSPNEQRLQLARRLTGNDRTLDVMALDVVWTAEFAEAGWALPLSDDPAGL
AENDAVADTLPGPLATAGWNHKLYAAPVTTNTQLLWYRPDLVNSPPTDWNAMIAEAARLH
AAGEPSWIAVQANQGEGLVVWFNTLLVSAGGSVLSEDGRHVTLTDTPAHRAATVSALQIL
KSVATTPGADPSITRTEEGSARLAFEQGKAALEVNWPFVFASMLENAVKGGVPFLPLNRI
PQLAGSINDIGTFTPSDEQFRIAYDASQQVFGFAPYPAVAPGQPAKVTIGGLNLAVAKTT
RHRAEAFEAVRCLRDQHNQRYVSLEGGLPAVRASLYSDPQFQAKYPMHAIIRQQLTDAAV
RPATPVYQALSIRLAAVLSPITEIDPESTADELAAQAQKAIDGMGLLP