Protein Info for Rv1226c in Mycobacterium tuberculosis H37Rv

Annotation: Probable transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 45 to 64 (20 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 212 to 238 (27 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 375 to 392 (18 residues), see Phobius details PF03703: bPH_2" amino acids 62 to 141 (80 residues), 55.5 bits, see alignment E=2.8e-19 amino acids 399 to 462 (64 residues), 25.3 bits, see alignment E=7.6e-10

Best Hits

KEGG orthology group: K08981, putative membrane protein (inferred from 100% identity to mbo:Mb1258c)

Predicted SEED Role

"transmembrane protein, distant homology with ydbT" in subsystem Experimental tye

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (487 amino acids)

>Rv1226c Probable transmembrane protein (Mycobacterium tuberculosis H37Rv)
MTDRPHDWHRLSPRMLLVHPVHEMLRQLPVLIGSVVLGSATGNPVWPLAALGVTVVFGVL
RWFFTTYRIDDENVSLRTGILSRRAVSVPRNRIRSVQTEARLLHRLLGLTVLRVGTGQEA
RGEAAFELDAVDSARVPRLRALLLAESLAPVEPTGRVLARWQSSWLRYAPLSFSGLVMIG
AVIGLGYQTGLAVRLPESGFARSAVDAAQRAGVVLVVAVTVLLVVGVSALLAVLFSWLTY
GNLLLRRGGSGQEGVLHLRHGLLRVREHTYDMRRLRGATLREPLLVRLLRGARLDAVMTG
VHGEGQSSMLLPPCPFETATAVLTDLIDNTDAAAGPLRRHGPAAARRRWTRALLVPTLAG
VALIAAAPILGVPGWAWTLWAVLTAGCAGLAVDRVRSLGHRVADGWLVARAGSLQRRRDC
IACTGIIGWTVRQTLFQRRAGVATLVAATVAGRKGYQVLDVPAELAWSVAGAASPWVADS
VWLRHGS