Protein Info for Rv1217c in Mycobacterium tuberculosis H37Rv

Annotation: Probable tetronasin-transport integral membrane protein ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 143 to 168 (26 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details amino acids 410 to 432 (23 residues), see Phobius details amino acids 450 to 470 (21 residues), see Phobius details amino acids 477 to 498 (22 residues), see Phobius details amino acids 521 to 541 (21 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to MEPRM_MYCTU: Multidrug efflux system permease protein Rv1217c (Rv1217c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to mbo:Mb1249c)

Predicted SEED Role

"PROBABLE TETRONASIN-TRANSPORT INTEGRAL MEMBRANE PROTEIN ABC TRANSPORTER"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (548 amino acids)

>Rv1217c Probable tetronasin-transport integral membrane protein ABC transporter (Mycobacterium tuberculosis H37Rv)
VSSTVIDRARPAGHRAPHRGSGFTGTLGLLRLYLRRDRVSLPLWVLLLSVPLATVYIASV
ETVYPDRSARAAAAAAIMASPAQRALYGPVYNDSLGAVGIWKAGMFHTLIAVAVILTVIR
HTRADEESGRAELIDSTVVGRYANLTGALLLSFGASIATGAIGALGLLATDVAPAGSVAF
GVALAASGMVFTAVAAVAAQLSPSARFTRAVAFAVLGTAFALRAIGDAGSGTLSWCSPLG
WSLQVRPYAGERWWVLLLSLATAAVLTVLAYRLRAGRDVGAGLIAERPGAGTAGPMLSEP
FGLAWRLNRGSLLLWTVGLCLYGLVMGSVVHGIGDQLGDNTAVRDIVTRMGGTGALEQAF
LALAFTMIGMVAAAFAVSLTLRLHQEETGLRAETLLAGAVSRTHWLASHLAMALAGSAVA
TLISGVAAGLAYGMTVGDVGGKLPTVVGTAAVQLPAVWLLSAVTVGLFGLAPRFTPVAWG
VLVGFIALYLLGSLAGFPQMLLNLEPFAHIPRVGGGDFTAVPLLWLLAIDAALITLGAMA
FRRRDVRC