Protein Info for Rv1215c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 TIGR00976: hydrolase CocE/NonD family protein" amino acids 51 to 561 (511 residues), 524.4 bits, see alignment E=2.3e-161 PF02129: Peptidase_S15" amino acids 55 to 294 (240 residues), 132.5 bits, see alignment E=3.5e-42 PF08530: PepX_C" amino acids 339 to 553 (215 residues), 82.6 bits, see alignment E=6.1e-27

Best Hits

KEGG orthology group: K06978, (no description) (inferred from 100% identity to mtf:TBFG_11239)

Predicted SEED Role

"Cocaine esterase (EC 3.1.1.-)" (EC 3.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-

Use Curated BLAST to search for 3.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (561 amino acids)

>Rv1215c Conserved protein (Mycobacterium tuberculosis H37Rv)
VARNPSPALDRPWRRPGALRYALERVRGVAKPPITVTDPPADVVIERDVEVPTRDGTLLR
INVFRSAEGGARPVIASIHPYGKDALPRRRGNRWTFSPQYRMLRQPKPLTFSALTGWEAP
DPAWWTAQGFVVVNADSRGCGRSDGTGDLLSHQEAEDTYDLVGWLADQAWSDGRVVMLGV
SYLAISQYAVAALQPPALRAICPWEGFTDAYRDLAFPGGIRESGFTRLWSRGVRRRTRQT
YDMEQMQEAHPLRDDFWRSRVPDLSAIKVPMLVCGSFSDNNLHSRGSIRAFTRSGCGHAR
LYTHRGGKWETFYSATALSEQLKFLRDALAGSSGSRSVRLEVREDRDTITAVREETQWPL
AGTRWRPMYLAGPGLLATEPPPTAGSIRFQTRSRAAAFNWTIPEDIELTGPMAARLWVQL
DGCDDANLFVGVEKWRDGQFVAFEGSYGWGRDRVTTGWQRVSLRELDPELSQPWEPVPAC
ARPRPVTAGEVVAVDVALGPSATLFRAGEQLRLVVGGRWLSPRNPLTGQFPAAYPRPPRG
RVTLHWGPRYDAHLLIPEVPG