Protein Info for Rv1185c in Mycobacterium tuberculosis H37Rv

Annotation: Probable fatty-acid-AMP ligase FadD21 (fatty-acid-AMP synthetase) (fatty-acid-AMP synthase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 transmembrane" amino acids 73 to 90 (18 residues), see Phobius details PF00501: AMP-binding" amino acids 11 to 414 (404 residues), 183.8 bits, see alignment E=4.7e-58 PF23024: AMP-dom_DIP2-like" amino acids 462 to 571 (110 residues), 32.7 bits, see alignment E=6.5e-12

Best Hits

Swiss-Prot: 100% identical to FAD21_MYCTO: Putative fatty-acid--CoA ligase fadD21 (fadD21) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K12423, fatty acid CoA ligase FadD21 (inferred from 100% identity to mtu:Rv1185c)

MetaCyc: 62% identical to long-chain fatty acid adenylyltransferase FadD28 (Mycobacterium tuberculosis variant bovis)
RXN-18531 [EC: 6.2.1.49]

Predicted SEED Role

"Long-chain fatty-acid-AMP ligase, Mycobacterial subgroup FadD28"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (578 amino acids)

>Rv1185c Probable fatty-acid-AMP ligase FadD21 (fatty-acid-AMP synthetase) (fatty-acid-AMP synthase) (Mycobacterium tuberculosis H37Rv)
MSDSSVLSLLRERAGLQPDDAAFTYIDYEQDWAGITETLTWSEVFRRTRIVAHEVRRHCT
TGDRAVILAPQGLAYIAAFLGSMQAGAIAVPLSVPQIGSHDERVSAVLADASPSVILTTS
AVAEAVAEHIHRPNTNNVGPIIEIDSLDLTGNSPSFRVKDLPSAAYLQYTSGSTRAPAGV
MISHRNLQANFQQLMSNYFGDRNGVAPPDTTIVSWLPFYHDMGLVLGIIAPILGGYRSEL
TSPLAFLQRPARWLHSLANGSPSWSAAPNFAFELAVRKTTDADIEGLDLGNVLGITSGAE
RVHPNTLSRFCNRFAPYNFREDMIRPSYGLAEATLYVASRNSGDKPEVVYFEPDKLSTGS
ANRCEPKTGTPLLSYGMPTSPTVRIVDPDTCIECPAGTIGEIWVKGDNVAEGYWNKPDET
RHTFGAMLVHPSAGTPDGSWLRTGDLGFLSEDEMFIVGRMKDMLIVYGRNHYPEDIESTV
QEITGGRVAAISVPVDHTEKLVTVIELKLLGDSAGEAMDELDVIKNNVTAAISRSHGLNV
ADLVLVPPGSIPTTTSGKIRRAACVEQYRLQQFTRLDG