Protein Info for Rv1178 in Mycobacterium tuberculosis H37Rv

Annotation: Probable aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03539: succinyldiaminopimelate transaminase
  • amino acids 5 to 361 (357 residues), 590.9 bits, E=4.2e-182
• PF00155: Aminotran_1_2
  • amino acids 27 to 360 (334 residues), 151.6 bits, E=1.7e-48

Best Hits

Swiss-Prot: 60% identical to OXYQ_STRRM: 4-dedimethylamino-4-oxo-anhydrotetracycline transaminase OxyQ (oxyQ) from Streptomyces rimosus

KEGG orthology group: None (inferred from 99% identity to mtc:MT1215)

MetaCyc: 60% identical to 4-dedimethylamino-4-oxo-anhydrotetracycline transaminase (Streptomyces rimosus rimosus ATCC 10970)
2.6.1.M2 [EC: 2.6.1.M2]

Predicted SEED Role

"N-succinyl-L,L-diaminopimelate aminotransferase alternative (EC 2.6.1.17)" in subsystem Lysine Biosynthesis DAP Pathway (EC 2.6.1.17)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• tetracycline and oxytetracycline biosynthesis (1/9 steps found)
• superpathway of tetracycline and oxytetracycline biosynthesis (1/17 steps found)

KEGG Metabolic Maps

• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.17

Use Curated BLAST to search for 2.6.1.17 or 2.6.1.M2

Protein Sequence (362 amino acids)

>Rv1178 Probable aminotransferase (Mycobacterium tuberculosis H37Rv)
VSASLPVFPWDTLADAKALAGAHPDGIVDLSVGTPVDPVAPLIQEALAAASAAPGYPATA
GTARLRESVVAALARRYGITRLTEAAVLPVIGTKELIAWLPTLLGLGGADLVVVPELAYP
TYDVGARLAGTRVLRADALTQLGPQSPALLYLNSPSNPTGRVLGVDHLRKVVEWARGRGV
LVVSDECYLGLGWDAEPVSVLHPSVCDGDHTGLLAVHSLSKSSSLAGYRAGFVVGDLEIV
AELLAVRKHAGMMVPAPVQAAMVAALDDDAHERQQRERYAQRRAALLPALGSAGFAVDYS
DAGLYLWATRGEPCRDSAAWLAQRGILVAPGDFYGPGGAQHVRVALTATDERVAAAVGRL
TC