Protein Info for Rv1104 in Mycobacterium tuberculosis H37Rv

Annotation: Possible para-nitrobenzyl esterase (fragment)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF00135: COesterase" amino acids 8 to 196 (189 residues), 237.4 bits, see alignment E=6e-74 PF20434: BD-FAE" amino acids 87 to 196 (110 residues), 30.1 bits, see alignment E=5.3e-11

Best Hits

KEGG orthology group: K01066, esterase / lipase [EC: 3.1.1.-] (inferred from 100% identity to mtf:TBFG_11125)

Predicted SEED Role

"Carboxylesterase (EC 3.1.1.1)" (EC 3.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-, 3.1.1.1

Use Curated BLAST to search for 3.1.1.- or 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>Rv1104 Possible para-nitrobenzyl esterase (fragment) (Mycobacterium tuberculosis H37Rv)
MVVDSCVAESRYGPVRGADDGRVKVWKGIRYAAPPLGDLRFRTPEPPERWTEVADATTFG
PACPQPAIPNMPLDLGASQSEDCWSLNIWAPADTEPGDGKPVMVWLHGGAYILGSGSQPL
YNGRRLAASGDVVVVTVNYRLGALGFLDLSSFNTSRRRFDSNIGLRDVLAVLRWVADNIA
VFGGDPEKVTLFGESARESSRPCSPPRRPRVCSRRRSPRAHRRHRSTTR