Protein Info for Rv1079 in Mycobacterium tuberculosis H37Rv

Annotation: Cystathionine gamma-synthase MetB (CGS) (O-succinylhomoserine [thiol]-lyase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01053: Cys_Met_Meta_PP
  • amino acids 16 to 387 (372 residues), 495.1 bits, E=2.1e-152
• PF06838: Met_gamma_lyase
  • amino acids 53 to 229 (177 residues), 26.8 bits, E=3.9e-10
• PF01041: DegT_DnrJ_EryC1
  • amino acids 62 to 238 (177 residues), 33.7 bits, E=5.1e-12
• PF00155: Aminotran_1_2
  • amino acids 83 to 192 (110 residues), 21.7 bits, E=2.1e-08

Best Hits

Swiss-Prot: 100% identical to METB_MYCTU: Cystathionine gamma-synthase (metB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01739, cystathionine gamma-synthase [EC: 2.5.1.48] (inferred from 100% identity to mbt:JTY_1110)

MetaCyc: 42% identical to O-succinyl-L-homoserine sulfhydrylase (Pseudomonas aeruginosa PAO1)
Cystathionine gamma-synthase. [EC: 2.5.1.48]

Predicted SEED Role

"Cystathionine gamma-lyase (EC 4.4.1.1)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.1)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine degradation I (5/6 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
• L-cysteine biosynthesis III (from L-homocysteine) (2/2 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• homocysteine and cysteine interconversion (3/4 steps found)
• D-serine degradation (2/3 steps found)
• L-methionine degradation II (2/3 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
• L-methionine biosynthesis I (3/5 steps found)
• superpathway of L-threonine metabolism (12/18 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• glycine betaine degradation III (4/7 steps found)
• superpathway of L-methionine salvage and degradation (10/16 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• glutathione-mediated detoxification I (2/8 steps found)
• purine nucleobases degradation II (anaerobic) (12/24 steps found)
• hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Cysteine metabolism
• Glycine, serine and threonine metabolism
• Methionine metabolism
• Nitrogen metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.48

Use Curated BLAST to search for 2.5.1.48 or 4.4.1.1

Protein Sequence (388 amino acids)

>Rv1079 Cystathionine gamma-synthase MetB (CGS) (O-succinylhomoserine [thiol]-lyase) (Mycobacterium tuberculosis H37Rv)
MSEDRTGHQGISGPATRAIHAGYRPDPATGAVNVPIYASSTFAQDGVGGLRGGFEYARTG
NPTRAALEASLAAVEEGAFARAFSSGMAATDCALRAMLRPGDHVVIPDDAYGGTFRLIDK
VFTRWDVQYTPVRLADLDAVGAAITPRTRLIWVETPTNPLLSIADITAIAELGTDRSAKV
LVDNTFASPALQQPLRLGADVVLHSTTKYIGGHSDVVGGALVTNDEELDEEFAFLQNGAG
AVPGPFDAYLTMRGLKTLVLRMQRHSENACAVAEFLADHPSVSSVLYPGLPSHPGHEIAA
RQMRGFGGMVSVRMRAGRRAAQDLCAKTRVFILAESLGGVESLIEHPSAMTHASTAGSQL
EVPDDLVRLSVGIEDIADLLGDLEQALG