Protein Info for Rv1004c in Mycobacterium tuberculosis H37Rv

Annotation: Probable membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 182 to 207 (26 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details amino acids 332 to 348 (17 residues), see Phobius details amino acids 359 to 377 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbo:Mb1031c)

Predicted SEED Role

"elastin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>Rv1004c Probable membrane protein (Mycobacterium tuberculosis H37Rv)
VSISCRVREGFVMRLAIVGTAAAAAIGGTLAVAPLTLSTPERVAGGTCSAGQQCDRLAAV
LMPDTATPSGPAAAEHAVPAPFEPVADTIAPGLVPRPGVPAAAAVPRVGPPAVPGLPNIP
GAAGPALPPPPALPNLAAPSVPGVGIPGIGIPGIGIPGIGIPGVPDPITGVNTAAAVVNG
VLGVGGTAAGVVTASAVAVTYLVLAVNALESSGILPTARGTASTVASLLLPGAQSAAAAL
PAVGLPALPGVTPASLLAMAAAAGLPGVGFPSLPGVSPTDLMAMAAAAGLPTSLPGLAGM
SPAELTALVAGGLPMLAAAGLPAGLAGVDPATLAAALPALAAGGLPPGLPALPGVDPAAL
AAALPALAAGLPALPAGLPPLPAVPALPAPPPLPGPPPLPALPSRLCTPGFGPIGVCIP