Protein Info for Rv1003 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 9 to 273 (265 residues), 193.9 bits, see alignment E=1.9e-61 PF00590: TP_methylase" amino acids 11 to 208 (198 residues), 97.7 bits, see alignment E=4.6e-32

Best Hits

Swiss-Prot: 100% identical to RSMI_MYCBO: Ribosomal RNA small subunit methyltransferase I (rsmI) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K07056, (no description) (inferred from 100% identity to mtc:MT1032)

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>Rv1003 Conserved protein (Mycobacterium tuberculosis H37Rv)
MSSGRLLLGATPLGQPSDASPRLAAALATADVVAAEDTRRVRKLAKALDIRIGGRVVSLF
DRVEALRVTALLDAINNGATVLVVSDAGTPVISDPGYRLVAACIDAGVSVTCLPGPSAVT
TALVMSGLPAEKFCFEGFAPRKGAARRAWLAELAEERRTCVFFESPRRLAACLNDAVEQL
GGARPAAICRELTKVHEEVVRGSLDELAIWAAGGVLGEITVVVAGAAPHAELSSLIAQVE
EFVAAGIRVKDACSEVAAAHPGVRTRQLYDAVLQSRRETGGPAQP