Protein Info for Rv0985c in Mycobacterium tuberculosis H37Rv

Annotation: Possible large-conductance ion mechanosensitive channel MscL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details TIGR00220: large conductance mechanosensitive channel protein" amino acids 1 to 123 (123 residues), 84.4 bits, see alignment E=3.8e-28 PF01741: MscL" amino acids 1 to 121 (121 residues), 112.8 bits, see alignment E=6.9e-37

Best Hits

Swiss-Prot: 100% identical to MSCL_MYCTO: Large-conductance mechanosensitive channel (mscL) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 99% identity to mbb:BCG_1040c)

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>Rv0985c Possible large-conductance ion mechanosensitive channel MscL (Mycobacterium tuberculosis H37Rv)
MLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQSDVGILRIG
IGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEIRDL
LAQTNGDSPGRHGGRGTPSPTDGPRASTESQ