Protein Info for Rv0959 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 PF27532: Mb0984_helical" amino acids 99 to 169 (71 residues), 104.6 bits, see alignment E=3.9e-34 PF27098: Rv0959_3rd" amino acids 427 to 476 (50 residues), 75.2 bits, see alignment 3.7e-25

Best Hits

Swiss-Prot: 100% identical to Y984_MYCBO: Uncharacterized protein Mb0984 (BQ2027_MB0984) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv0959)

Predicted SEED Role

"FIG019045: long form Mg-chelase associated protein with vWA domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (672 amino acids)

>Rv0959 Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv)
MAKSDGDDPLRPASPRLRSSRRHSLRYSAYTGGPDPLAPPVDLRDALEQIGQDVMAGASP
RRALSELLRRGTRNLTGADRLAAEVNRRRRELLRRNNLDGTLQEIKKLLDEAVLAERKEL
ARALDDDARFAELQLDALPASPAKAVQELAEYRWRSGQAREKYEQIKDLLGRELLDQRFA
GMKQALAGATDDDRRRVTEMLDDLNDLLDKHARGEDTQRDFDEFMTKHGEFFPENPRNVE
ELLDSLAKRAAAAQRFRNSLSQEQRDELDALAQQAFGSPALMRALDRLDAHLQAARPGED
WTGSQQFSGDNPFGMGEGTQALADIAELEQLAEQLSQSYPGASMDDVDLDALARQLGDQA
AVDARTLAELERALVNQGFLDRGSDGQWRLSPKAMRRLGETALRDVAQQLSGRHGERDHR
RAGAAGELTGATRPWQFGDTEPWHVARTLTNAVLRQAAAVHDRIRITVEDVEVAETETRT
QAAVALLVDTSFSMVMENRWLPMKRTALALHHLVCTRFRSDALQIIAFGRYARTVTAAEL
TGLAGVYEQGTNLHHALALAGRHLRRHAGAQPVVLVVTDGEPTAHLEDFDGDGTSVFFDY
PPHPRTIAHTVRGFDDMARLGAQVTIFRLGSDPGLARFIDQVARRVQGRVVVPDLDGLGA
AVVGDYLRFRRR