Protein Info for Rv0924c in Mycobacterium tuberculosis H37Rv

Annotation: Divalent cation-transport integral membrane protein MntH (BRAMP) (MRAMP)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 32 to 49 (18 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 109 to 134 (26 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 256 to 279 (24 residues), see Phobius details amino acids 301 to 330 (30 residues), see Phobius details amino acids 342 to 360 (19 residues), see Phobius details amino acids 366 to 385 (20 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details TIGR01197: metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family" amino acids 33 to 394 (362 residues), 283.9 bits, see alignment E=1.2e-88 PF01566: Nramp" amino acids 52 to 400 (349 residues), 383 bits, see alignment E=7e-119

Best Hits

Swiss-Prot: 100% identical to MNTH_MYCTO: Divalent metal cation transporter MntH (mntH) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03322, manganese transport protein (inferred from 100% identity to mbt:JTY_0946)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>Rv0924c Divalent cation-transport integral membrane protein MntH (BRAMP) (MRAMP) (Mycobacterium tuberculosis H37Rv)
VAGEFRLLSHLCSRGSKVGELAQDTRTSLKTSWYLLGPAFVAAIAYVDPGNVAANVSSGA
QFGYLLLWVIVAANVMAALVQYLSAKLGLVTGRSLPEAIGKRMGRPARLAYWAQAEIVAM
ATDVAEVIGGAIALRIMFNLPLPIGGIITGVVSLLLLTIQDRRGQRLFERVITALLLVIA
IGFTASFFVVTPPPNAVLGGLAPRFQGTESVLLAAAIMGATVMPHAVYLHSGLARDRHGH
PDPGPQRRRLLRVTRWDVGLAMLIAGGVNAAMLLVAALNMRGRGDTASIEGAYHAVHDTL
GATIAVLFAVGLLASGLASSSVGAYAGAMIMQGLLHWSVPMLVRRLITLGPALAILTLGF
DPTRTLVLSQVVLSFGIPFAVLPLVKLTGSPAVMGGDTNHRATTWVGWVVAVMVSLLNVM
LIYLTVTG