Protein Info for Rv0899 in Mycobacterium tuberculosis H37Rv

Annotation: Outer membrane protein A OmpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details PF21923: BON_like" amino acids 82 to 128 (47 residues), 88.5 bits, see alignment 3e-29 PF04972: BON" amino acids 150 to 195 (46 residues), 27.6 bits, see alignment 4.5e-10 PF00691: OmpA" amino acids 225 to 319 (95 residues), 80.7 bits, see alignment E=1.3e-26

Best Hits

Swiss-Prot: 100% identical to ARFA_MYCTU: Peptidoglycan-binding protein ArfA (arfA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03286, OmpA-OmpF porin, OOP family (inferred from 100% identity to mbb:BCG_0951)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>Rv0899 Outer membrane protein A OmpA (Mycobacterium tuberculosis H37Rv)
VASKAGLGQTPATTDARRTQKFYRGSPGRPWLIGAVVIPLLIAAIGYGAFERPQSVTGPT
GVLPTLTPTSTRGASALSLSLLSISRSGNTVTLIGDFPDEAAKAALMTALNGLLAPGVNV
IDQIHVDPVVRSLDFSSAEPVFTASVPIPDFGLKVERDTVTLTGTAPSSEHKDAVKRAAT
STWPDMKIVNNIEVTGQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEIL
NRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGL
GSVNPIASNATPEGRAKNRRVEIVVN