Protein Info for Rv0876c in Mycobacterium tuberculosis H37Rv

Annotation: Possible conserved transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 transmembrane" amino acids 113 to 137 (25 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details amino acids 411 to 441 (31 residues), see Phobius details amino acids 480 to 510 (31 residues), see Phobius details PF07690: MFS_1" amino acids 122 to 484 (363 residues), 45.7 bits, see alignment E=2.3e-16

Best Hits

Swiss-Prot: 100% identical to Y876_MYCTU: Uncharacterized protein Rv0876c (Rv0876c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbo:Mb0900c)

Predicted SEED Role

"possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (548 amino acids)

>Rv0876c Possible conserved transmembrane protein (Mycobacterium tuberculosis H37Rv)
MAPTPGRRTRNGSVNGHPGMANYPPDDANYRRSRRPPPMPSANRYLPPLGEQPEPERSRV
PPRTTRAGERITVTRAAAMRSREMGSRMYLLVHRAATADGADKSGLTALTWPVMANFAVD
SAMAVALANTLFFAAASGESKSRVALYLLITIAPFAVIAPLIGPALDRLQHGRRVALALS
FGLRTALAVVLIMNYDGATGSFPSWVLYPCALAMMVFSKSFSVLRSAVTPRVMPPTIDLV
RVNSRLTVFGLLGGTIAGGAIAAGVEFVCTHLFQLPGALFVVVAITIAGASLSMRIPRWV
EVTSGEVPATLSYHRDRGRLRRRWPEEVKNLGGTLRQPLGRNIITSLWGNCTIKVMVGFL
FLYPAFVAKAHEANGWVQLGMLGLIGAAAAVGNFAGNFTSARLQLGRPAVLVVRCTVLVT
VLAIAAAVAGSLAATAIATLITAGSSAIAKASLDASLQHDLPEESRASGFGRSESTLQLA
WVLGGAVGVLVYTELWVGFTAVSALLILGLAQTIVSFRGDSLIPGLGGNRPVMAEQETTR
RGAAVAPQ