Protein Info for Rv0870c in Mycobacterium tuberculosis H37Rv

Annotation: Possible conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 29 to 50 (22 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details PF03733: YccF" amino acids 4 to 54 (51 residues), 66.9 bits, see alignment E=9.8e-23 amino acids 68 to 118 (51 residues), 64.4 bits, see alignment E=5.9e-22

Best Hits

Swiss-Prot: 37% identical to YCCF_SHIFL: Inner membrane protein YccF (yccF) from Shigella flexneri

KEGG orthology group: None (inferred from 99% identity to mbo:Mb0894c)

Predicted SEED Role

"FIG020413: transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (129 amino acids)

>Rv0870c Possible conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
MRLILNVIWLVFGGLWLALGYLLASLVCFLLIITIPFGFAALRIASYALWPFGRTIVEKP
TAGTGALIGNVIWVLLFGIWLALGHLVSAAAMAVTIIGIPLALANLKLIPVSLVPLGKDI
VGVNSQVPT