Protein Info for Rv0844c in Mycobacterium tuberculosis H37Rv

Annotation: Possible nitrate/nitrite response transcriptional regulatory protein NarL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF00072: Response_reg" amino acids 11 to 122 (112 residues), 88.7 bits, see alignment E=3e-29 PF00196: GerE" amino acids 154 to 207 (54 residues), 56.2 bits, see alignment E=2.2e-19

Best Hits

Swiss-Prot: 100% identical to NARL_MYCTO: Probable transcriptional regulatory protein NarL (narL) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K07684, two-component system, NarL family, nitrate/nitrite response regulator NarL (inferred from 100% identity to mbo:Mb0867c)

Predicted SEED Role

"DNA-binding response regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>Rv0844c Possible nitrate/nitrite response transcriptional regulatory protein NarL (Mycobacterium tuberculosis H37Rv)
MSNPQPEKVRVVVGDDHPLFREGVVRALSLSGSVNVVGEADDGAAALELIKAHLPDVALL
DYRMPGMDGAQVAAAVRSYELPTRVLLISAHDEPAIVYQALQQGAAGFLLKDSTRTEIVK
AVLDCAKGRDVVAPSLVGGLAGEIRQRAAPVAPVLSAREREVLNRIACGQSIPAIAAELY
VAPSTVKTHVQRLYEKLGVSDRAAAVAEAMRQRLLD