Protein Info for Rv0822c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 684 transmembrane" amino acids 175 to 194 (20 residues), see Phobius details TIGR00350: cell envelope-related function transcriptional attenuator common domain" amino acids 253 to 429 (177 residues), 209 bits, see alignment E=2.1e-66 PF03816: LytR_cpsA_psr" amino acids 254 to 428 (175 residues), 139.2 bits, see alignment E=1.3e-44 PF13399: LytR_C" amino acids 557 to 641 (85 residues), 62.5 bits, see alignment E=5.7e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_10837)

Predicted SEED Role

"Cell envelope-associated transcriptional attenuator LytR-CpsA-Psr, subfamily A1 (as in PMID19099556)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (684 amino acids)

>Rv0822c Conserved protein (Mycobacterium tuberculosis H37Rv)
MSDGESAAPWARLSESAFPDGVDRWITVPPATWVAAQGPRDTQNVGCHATGAVSVADLIA
RLGPAFPDLPTHRHVAPEPEPSGRGPKVHDDADDQQDTEAIAIPAHSLEFLSELPDLRAA
NYPRADHARREPELPGKQLTGSARVRPLRIRRTSPAPAKPAPNSGRRPMVLAARSLAALF
AALALALTGGAWQWSASKNSRLNMVSALDPHSGDIVNPSGQHGDENFLLVGMDSRAGANA
NIGAGDAEDAGGARSDTVMLVNIPASRERVVAVSFPRDLAITPIQCEAWNPETGKYGPIY
DEKTGTMGPRLVYTETKLNSAFSFGGPKCLVKVIQKLSGLSINRFIAIDFVGFARMVEAL
GGVEVCSTTPLRDYELGTVLEHAGRQVIDGPTALNYVRARQVTTESNGDYGRIKRQQLFL
SSLLRSMISTDTLFNLSRLNNVVNMFIGNSYVDNVKTKDLVELGRSLQHMAAGHVTFVTV
PTGITDQNGDEPPRTSDMKALFTAIIDDDPLPLENDHNAQRLGNTPSTPPTTTKKAPQAG
LTNEIQHQQVTTTSPKEVTVQVSNSTGQAGLATTATDQLKRNGFNVMAPDDYPSSLLATT
VFFSPGNEQAAATVAAVFGQSKIERVTGIGQLVQVVLGQDFSAVRAPLPSGSTVSVQISR
NSSSPPTKLPEDLTVTNAADTTCE