Protein Info for Rv0806c in Mycobacterium tuberculosis H37Rv

Annotation: Possible UDP-glucose-4-epimerase CpsY (galactowaldenase) (UDP-galactose-4-epimerase) (uridine diphosphate galactose-4-epimerase) (uridine diphospho-galactose-4-epimerase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 PF17101: Stealth_CR1" amino acids 201 to 221 (21 residues), 36.7 bits, see alignment (E = 5.4e-13) PF11380: Stealth_CR2" amino acids 239 to 342 (104 residues), 136.3 bits, see alignment E=9e-44 PF17102: Stealth_CR3" amino acids 389 to 435 (47 residues), 68.3 bits, see alignment 8.6e-23 PF17103: Stealth_CR4" amino acids 465 to 518 (54 residues), 60.5 bits, see alignment 2.5e-20

Best Hits

Swiss-Prot: 100% identical to CPSY_MYCTO: Exopolysaccharide phosphotransferase CpsY (cpsY) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_00820)

Predicted SEED Role

"probable UDP-glucose-4-epimerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (532 amino acids)

>Rv0806c Possible UDP-glucose-4-epimerase CpsY (galactowaldenase) (UDP-galactose-4-epimerase) (uridine diphosphate galactose-4-epimerase) (uridine diphospho-galactose-4-epimerase) (Mycobacterium tuberculosis H37Rv)
MPKISSRDGGRPAQRTVNPIIVTRRGKIARLESGLTPQEAQIEDLVFLRKVLNRADIPYL
LIRNHKNRPVLAINIELRAGLERALAAACATEPMYAKTIDEPGLSPVLVATDGLSQLVDP
RVVRLYRRRIAPGGFRYGPAFGVELQFWVYEETVIRCPVENSLSRKVLPRNEITPTNVKL
YGYKWPTLDGMFAPHASDVVFDIDMVFSWVDGSDPEFRARRMAQMSQYVVGEGDDAEARI
RQIDELKYALRSVNMFAPWIRRIFIATDSTPPPWLAEHPKITIVRAEDHFSDRSALPTYN
SHAVESQLHHIPGLSEHFLYSNDDMFFGRPLKASMFFSPGGVTRFIEAKTRIGLGANNPA
RSGFENAARVNRQLLFDRFGQVITRHLEHTAVPLRKSVLIEMEREFPEEFARTAASPFRS
DTDISVTNSFYHYYALMTGRAVPQEKAKVLYVDTTSYAGLRLLPKLRKHRGYDFFCLNDG
SFPEVPAAQRAERVVSFLERYFPIPAPWEKIAADVSRRDFAVPRTSAPSEGA