Protein Info for Rv0802c in Mycobacterium tuberculosis H37Rv

Annotation: Possible succinyltransferase in the GCN5-related N-acetyltransferase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF13302: Acetyltransf_3" amino acids 16 to 164 (149 residues), 50.3 bits, see alignment E=2.2e-17

Best Hits

Swiss-Prot: 100% identical to Y802_MYCTU: Putative succinyl-CoA transferase Rv0802c (Rv0802c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_00816)

Predicted SEED Role

"FIG00821487: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>Rv0802c Possible succinyltransferase in the GCN5-related N-acetyltransferase family (Mycobacterium tuberculosis H37Rv)
MSRHWPLFDLRITTPRLQLQLPTEELCDQLIDTILEGVHDPDRMPFSVPWTRASREDLPF
NTLSHLWQQLAGFKRDDWSLPLAVLVDGRAVGVQALSSKDFPITRQVDSGSWLGLRYQGH
GYGTEMRAAVLYFAFAELEAQVATSRSFVDNPASIAVSRRNGYRDNGLDRVAREGAMAEA
LLFRLTRDDWQRHRTVEVRVDGFDRCRPLFGPLEPPRY