Protein Info for Rv0777 in Mycobacterium tuberculosis H37Rv

Annotation: Probable adenylosuccinate lyase PurB (adenylosuccinase) (ASL) (ASASE)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00928: adenylosuccinate lyase
  • amino acids 7 to 450 (444 residues), 482.1 bits, E=7.6e-149
• PF00206: Lyase_1
  • amino acids 31 to 297 (267 residues), 85.3 bits, E=5.6e-28
• PF10397: ADSL_C
  • amino acids 366 to 449 (84 residues), 58 bits, E=9.7e-20

Best Hits

KEGG orthology group: K01756, adenylosuccinate lyase [EC: 4.3.2.2] (inferred from 100% identity to mbo:Mb0800)

Predicted SEED Role

"Adenylosuccinate lyase (EC 4.3.2.2)" in subsystem De Novo Purine Biosynthesis or Purine conversions (EC 4.3.2.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (14/14 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)
• dZTP biosynthesis (3/5 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.2

Protein Sequence (472 amino acids)

>Rv0777 Probable adenylosuccinate lyase PurB (adenylosuccinase) (ASL) (ASASE) (Mycobacterium tuberculosis H37Rv)
VSIPNVLATRYASAEMVAIWSPEAKVVSERRLWLAVLRAQAELGVAVADSVLADYERVVD
DVDLASISARERVLRHDVKARIEEFNALAGHEHVHKGMTSRDLTENVEQLQIRRSLEVIF
AHGVAAVARLAERAVSYRDLIMAGRSHNVAAQATTLGKRFASAAQEMMIALRRLRELIDR
YPLRGIKGPMGTGQDMLDLLGGDRAALADLERRVADFLGFATVFNSVGQVYPRSLDHDVV
SALVQLGAGPSSLAHTIRLMAGHELATEGFAPGQVGSSAMPHKMNTRSCERVNGLQVVLR
GYASMVAELAGAQWNEGDVFCSVVRRVALPDSFFAVDGQIETFLTVLDEFGAYPAVIGRE
LDRYLPFLATTKVLMAAVRAGMGRESAHRLISEHAVATALAMREHGAEPDLLDRLAADPR
LTLGRDALEAALADKKAFAGAAGDQVDDVVAMVDALVSRYPDAAKYTPGAIL